Lineage for d6hcpc_ (6hcp C:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. Family f.4.3.0: automated matches [267625] (1 protein)
    not a true family
  6. Protein automated matches [267676] (11 species)
    not a true protein
  7. Species Acinetobacter baumannii [TaxId:470] [317226] (4 PDB entries)
  8. Domain d6hcpc_: 6hcp C: [358538]
    automated match to d5fp1a_
    complexed with c8e, edo, po4

Details for d6hcpc_

PDB Entry: 6hcp (more details), 1.83 Å

PDB Description: crystal structure of baua, the ferric preacinetobactin receptor from acinetobacter baumannii
PDB Compounds: (C:) BauA

SCOPe Domain Sequences for d6hcpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcpc_ f.4.3.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddygyriipgfsdpvitni
ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
rtymlsvsydf

SCOPe Domain Coordinates for d6hcpc_ are not available.

Timeline for d6hcpc_:

Domains from other chains:
(mouse over for more information)
d6hcpa_, d6hcpb_