Lineage for d5fp1a_ (5fp1 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022367Family f.4.3.0: automated matches [267625] (1 protein)
    not a true family
  6. 3022368Protein automated matches [267676] (11 species)
    not a true protein
  7. 3022369Species Acinetobacter baumannii [TaxId:470] [317226] (4 PDB entries)
  8. 3022373Domain d5fp1a_: 5fp1 A: [317237]
    automated match to d1by3a_
    complexed with c8e, po4

Details for d5fp1a_

PDB Entry: 5fp1 (more details), 1.94 Å

PDB Description: crystal structure of the siderophore receptor piua from acinetobacter baumannii
PDB Compounds: (A:) tonb-dependent siderophore receptor

SCOPe Domain Sequences for d5fp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fp1a_ f.4.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
tqeeslkvdqsanskfvaplldtpksvsviskqliedtkvttladalrtvpgitlgageg
gnpngdrpfirgyssessmyidgirnstsqnremfaveqvevtkgsasamggagsvggsi
nmiskvakkgdflegsvaagtdnyqritldgnkdfgngiaarvavlghqnekagqsngae
ykrvgiapsitfgldtptratlsyyylqtddkpdsgipywdsslgkaqgkpaevkqgtyy
gwkdrdfqkqenhigtiklehdltdnititntamyakskndyvwtnpddskgnvgkglvw
hrlnsaitdsetftdqlaltgkfdtgflkhrfnvgaeyskqktdkggyniidakgnvsst
gfysdcsdlstnwctslngptqkpfvdrlqarpdfdatvestsvylldnieitpkwlldl
glrwdkfeaeqnflatssaaaytaknnsdfvtyqagitfkptengsiytsyatsaspvgl
nagwgdnsetinannqmidpeeaqtfeigtkwdfldnhlnltaaifrtekqntrvqidpt
tyanvgeskvdgfelglngeitdkwnisagytyldseltkngkscrsgkctdqsiyngnq
mpnvpkqaatlwttykvlpqltvgagavysdkvygdvantkwvpsyvrydamarynvnkn
vdlqlninnlsdkryftkayashyateaegrsavlavnfky

SCOPe Domain Coordinates for d5fp1a_:

Click to download the PDB-style file with coordinates for d5fp1a_.
(The format of our PDB-style files is described here.)

Timeline for d5fp1a_: