Lineage for d1rpja_ (1rpj A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) 
Protein D-allose-binding protein [53828] (1 species) Species Escherichia coli [TaxId:562] [53829] (1 PDB entry) 
Domain d1rpja_: 1rpj A: [35656]
Details for d1rpja_
PDB Entry: 1rpj (more details), 1.8 Å
PDB Description: crystal structure of d-allose binding protein from escherichia coli
SCOP Domain Sequences for d1rpja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rpja_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli}
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq
SCOP Domain Coordinates for d1rpja_:
Click to download the PDB-style file with coordinates for d1rpja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rpja_:
- d1rpja_ appears in SCOP 1.57
- d1rpja_ appears in the current release, SCOPe 2.08
View in 3D