Lineage for d1rpja_ (1rpj A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75160Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 75161Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 75162Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 75169Protein D-allose-binding protein [53828] (1 species)
  7. 75170Species Escherichia coli [TaxId:562] [53829] (1 PDB entry)
  8. 75171Domain d1rpja_: 1rpj A: [35656]

Details for d1rpja_

PDB Entry: 1rpj (more details), 1.8 Å

PDB Description: crystal structure of d-allose binding protein from escherichia coli

SCOP Domain Sequences for d1rpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpja_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli}
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq

SCOP Domain Coordinates for d1rpja_:

Click to download the PDB-style file with coordinates for d1rpja_.
(The format of our PDB-style files is described here.)

Timeline for d1rpja_: