Lineage for d1rpja_ (1rpj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2912930Protein D-allose-binding protein [53828] (1 species)
  7. 2912931Species Escherichia coli [TaxId:562] [53829] (3 PDB entries)
  8. 2912934Domain d1rpja_: 1rpj A: [35656]
    complexed with all, so4, zn

Details for d1rpja_

PDB Entry: 1rpj (more details), 1.8 Å

PDB Description: crystal structure of d-allose binding protein from escherichia coli
PDB Compounds: (A:) protein (precursor of periplasmic sugar receptor)

SCOPe Domain Sequences for d1rpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpja_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]}
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq

SCOPe Domain Coordinates for d1rpja_:

Click to download the PDB-style file with coordinates for d1rpja_.
(The format of our PDB-style files is described here.)

Timeline for d1rpja_: