Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries) |
Domain d6gr0c_: 6gr0 C: [356068] automated match to d4gh7a_ complexed with f8w, ga |
PDB Entry: 6gr0 (more details), 2.5 Å
SCOPe Domain Sequences for d6gr0c_:
Sequence, based on SEQRES records: (download)
>d6gr0c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} ipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksynvt nvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktvv qnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
>d6gr0c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} ipapplskvplqqnfqdnqfhgkwyvvgfaeniqdppkmiatiyelkedksynvtnvasn wekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktvvqnrek fwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
Timeline for d6gr0c_: