![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries) |
![]() | Domain d6gr0b_: 6gr0 B: [356064] automated match to d4gh7a_ complexed with f8w, ga |
PDB Entry: 6gr0 (more details), 2.5 Å
SCOPe Domain Sequences for d6gr0b_:
Sequence, based on SEQRES records: (download)
>d6gr0b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} lipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksynv tnvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktv vqnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
>d6gr0b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} lipapplskvplqqnfqdnqfhgkwyvvgfaeniqdppkmiatiyelkedksynvtnvas nwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktvvqnre kfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
Timeline for d6gr0b_: