PDB entry 6gr0

View 6gr0 on RCSB PDB site
Description: Petrobactin-binding engineered lipocalin in complex with gallium-petrobactin
Class: transport protein
Keywords: anticalin, beta-barrel, petrobactin, lcn2, lipocalin, ngal, protein engineering, transport protein
Deposited on 2018-06-08, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (Start-173)
      • engineered mutation (23)
      • engineered mutation (31)
      • engineered mutation (33)
      • engineered mutation (35-37)
      • engineered mutation (44)
      • engineered mutation (47)
      • engineered mutation (63)
      • engineered mutation (65-69)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (76)
      • engineered mutation (82)
      • engineered mutation (91)
      • engineered mutation (95)
      • engineered mutation (98)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (127)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d6gr0a_
  • Chain 'B':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (Start-173)
      • engineered mutation (23)
      • engineered mutation (31)
      • engineered mutation (33)
      • engineered mutation (35-36)
      • engineered mutation (44)
      • engineered mutation (47)
      • engineered mutation (63)
      • engineered mutation (65-69)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (76)
      • engineered mutation (82)
      • engineered mutation (91)
      • engineered mutation (95)
      • engineered mutation (98)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (127)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d6gr0b_
  • Chain 'C':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (Start-173)
      • engineered mutation (23)
      • engineered mutation (31)
      • engineered mutation (33)
      • engineered mutation (35-36)
      • engineered mutation (44)
      • engineered mutation (47)
      • engineered mutation (63)
      • engineered mutation (65-69)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (76)
      • engineered mutation (82)
      • engineered mutation (91)
      • engineered mutation (95)
      • engineered mutation (98)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (127)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d6gr0c_
  • Heterogens: F8W, GA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gr0A (A:)
    sdlipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksy
    nvtnvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffk
    tvvqnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr0A (A:)
    dlipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksyn
    vtnvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffkt
    vvqnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gr0B (B:)
    sdlipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksy
    nvtnvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffk
    tvvqnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr0B (B:)
    lipapplskvplqqnfqdnqfhgkwyvvgfaeniqdppkmiatiyelkedksynvtnvas
    nwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktvvqnre
    kfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gr0C (C:)
    sdlipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksy
    nvtnvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffk
    tvvqnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr0C (C:)
    ipapplskvplqqnfqdnqfhgkwyvvgfaeniqdppkmiatiyelkedksynvtnvasn
    wekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktvvqnrek
    fwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg