SCOPe 2.08: Domain d6ghdc_: 6ghd C:

Lineage for d6ghdc_ (6ghd C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)
   contains one classic and one pseudo HhH motifs
   automatically mapped to Pfam PF02961

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (24 PDB entries)

8. Domain d6ghdc_: 6ghd C: [355775]
   Other proteins in same PDB: d6ghdb_, d6ghdf_, d6ghdg1, d6ghdg2, d6ghdh_
   automated match to d1ci4a_
   complexed with edo, so4

Details for d6ghdc_

PDB Entry: 6ghd, 2.1 Å

PDB Description: structural analysis of the ternary complex between lamin a/c, baf and emerin identifies an interface disrupted in autosomal recessive progeroid diseases

PDB Compounds: (C:) barrier-to-autointegration factor

SCOPe Domain Sequences for d6ghdc_:

Sequence; same for both SEQRES and ATOM records:

>d6ghdc_ a.60.5.1 (C:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
tsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfrew
lkdtaganakqsrdafgalrewadafl

Timeline for d6ghdc_:

• d6ghdc_ first appeared in SCOPe 2.07