![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
![]() | Superfamily a.140.1: LEM domain [63451] (1 family) ![]() |
![]() | Family a.140.1.1: LEM domain [63452] (3 proteins) |
![]() | Protein Inner nuclear membrane protein emerin [63455] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63456] (5 PDB entries) |
![]() | Domain d6ghdh_: 6ghd H: [355758] Other proteins in same PDB: d6ghda_, d6ghdb_, d6ghdc_, d6ghdd_, d6ghde_, d6ghdf_, d6ghdg2 automated match to d1jeia_ complexed with edo, so4 |
PDB Entry: 6ghd (more details), 2.1 Å
SCOPe Domain Sequences for d6ghdh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ghdh_ a.140.1.1 (H:) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]} dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetq
Timeline for d6ghdh_: