Lineage for d6ghdh_ (6ghd H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734562Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2734563Superfamily a.140.1: LEM domain [63451] (1 family) (S)
  5. 2734564Family a.140.1.1: LEM domain [63452] (3 proteins)
  6. 2734565Protein Inner nuclear membrane protein emerin [63455] (1 species)
  7. 2734566Species Human (Homo sapiens) [TaxId:9606] [63456] (5 PDB entries)
  8. 2734569Domain d6ghdh_: 6ghd H: [355758]
    Other proteins in same PDB: d6ghda_, d6ghdb_, d6ghdc_, d6ghdd_, d6ghde_, d6ghdf_, d6ghdg2
    automated match to d1jeia_
    complexed with edo, so4

Details for d6ghdh_

PDB Entry: 6ghd (more details), 2.1 Å

PDB Description: structural analysis of the ternary complex between lamin a/c, baf and emerin identifies an interface disrupted in autosomal recessive progeroid diseases
PDB Compounds: (H:) emerin

SCOPe Domain Sequences for d6ghdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghdh_ a.140.1.1 (H:) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetq

SCOPe Domain Coordinates for d6ghdh_:

Click to download the PDB-style file with coordinates for d6ghdh_.
(The format of our PDB-style files is described here.)

Timeline for d6ghdh_: