Lineage for d6ghda_ (6ghd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715850Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
    contains one classic and one pseudo HhH motifs
    automatically mapped to Pfam PF02961
  5. 2715851Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)
  6. 2715852Protein Barrier-to-autointegration factor, BAF [47800] (1 species)
  7. 2715853Species Human (Homo sapiens) [TaxId:9606] [47801] (24 PDB entries)
  8. 2715886Domain d6ghda_: 6ghd A: [355777]
    Other proteins in same PDB: d6ghdb_, d6ghdf_, d6ghdg1, d6ghdg2, d6ghdh_
    automated match to d1ci4a_
    complexed with edo, so4

Details for d6ghda_

PDB Entry: 6ghd (more details), 2.1 Å

PDB Description: structural analysis of the ternary complex between lamin a/c, baf and emerin identifies an interface disrupted in autosomal recessive progeroid diseases
PDB Compounds: (A:) barrier-to-autointegration factor

SCOPe Domain Sequences for d6ghda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghda_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre
wlkdtaganakqsrdafgalrewadafl

SCOPe Domain Coordinates for d6ghda_:

Click to download the PDB-style file with coordinates for d6ghda_.
(The format of our PDB-style files is described here.)

Timeline for d6ghda_: