Lineage for d6g3ua_ (6g3u A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479470Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2479471Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2479770Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 proteins)
    the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion
    automatically mapped to Pfam PF03971
  6. 2479777Protein automated matches [190493] (6 species)
    not a true protein
  7. 3055577Species Pseudomonas aeruginosa [TaxId:287] [355639] (1 PDB entry)
  8. 3055578Domain d6g3ua_: 6g3u A: [355640]
    automated match to d2b0ta_
    complexed with akg, nap

Details for d6g3ua_

PDB Entry: 6g3u (more details), 2.71 Å

PDB Description: structure of pseudomonas aeruginosa isocitrate dehydrogenase, idh
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d6g3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g3ua_ c.77.1.2 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
skitytftdeapalatysllpivkafaasagidvetsdislagrilanfadrleadqrie
ddlarlavlatspdaniiklpnisasvpqlkgaiaelqglgykvpdfpedpqtdeekevr
aryakilgsavnpvlregnsdrrapaavkayarkhphsmgkwsmasrshadymrggdffs
seqsitmakagdvriefvgkdgkvevkkqlslqegevldsmfmscgklrdffektlqdck
etgvmwslhvkatmmkishpivfghavsvyykdvfdkwgqlfeelgvnpnngissvydki
kslpasqqeeilhdihevyshrpemamvdsvkgitnlhipsdvivdasmpamirnsgqmw
gkdgkqkdtkavmpestyariyqeminfcktngafdpttmgsvpnvglmaqkaeeygshd
ktfemtadgtmrvvladgsvlmqhkvetgdiwracqtkdapirdwvklavtrarqsdtpa
ifwldperahdrelrkkvelylkdhdltgldisimgyneairvsmerlirgkdtisvtgn
vlrdyltdlfpimelgtsakmlsivplmagggmyetgaggsapkhvqqlveenylrwdsl
geflalavsleetgiktgnakakllgkaldeatgklldnnkspsrkvgdidnrgshfyla
mywaqalaaqnedaelkahfaplakalteqeativaelnavqgkpaeiggyyrsnpelts
kvmrpsatfnaaidsla

SCOPe Domain Coordinates for d6g3ua_:

Click to download the PDB-style file with coordinates for d6g3ua_.
(The format of our PDB-style files is described here.)

Timeline for d6g3ua_:

  • d6g3ua_ is new in SCOPe 2.07-stable