PDB entry 6g3u

View 6g3u on RCSB PDB site
Description: Structure of Pseudomonas aeruginosa Isocitrate Dehydrogenase, IDH
Class: oxidoreductase
Keywords: Isocitrate dehydrogenase, TCA cycle, metabolism, Pseudomonas aeruginosa, OXIDOREDUCTASE
Deposited on 2018-03-26, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: idh, PA2624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g3ua_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: idh, PA2624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g3ub_
  • Heterogens: NAP, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g3uA (A:)
    skitytftdeapalatysllpivkafaasagidvetsdislagrilanfadrleadqrie
    ddlarlavlatspdaniiklpnisasvpqlkgaiaelqglgykvpdfpedpqtdeekevr
    aryakilgsavnpvlregnsdrrapaavkayarkhphsmgkwsmasrshadymrggdffs
    seqsitmakagdvriefvgkdgkvevkkqlslqegevldsmfmscgklrdffektlqdck
    etgvmwslhvkatmmkishpivfghavsvyykdvfdkwgqlfeelgvnpnngissvydki
    kslpasqqeeilhdihevyshrpemamvdsvkgitnlhipsdvivdasmpamirnsgqmw
    gkdgkqkdtkavmpestyariyqeminfcktngafdpttmgsvpnvglmaqkaeeygshd
    ktfemtadgtmrvvladgsvlmqhkvetgdiwracqtkdapirdwvklavtrarqsdtpa
    ifwldperahdrelrkkvelylkdhdltgldisimgyneairvsmerlirgkdtisvtgn
    vlrdyltdlfpimelgtsakmlsivplmagggmyetgaggsapkhvqqlveenylrwdsl
    geflalavsleetgiktgnakakllgkaldeatgklldnnkspsrkvgdidnrgshfyla
    mywaqalaaqnedaelkahfaplakalteqeativaelnavqgkpaeiggyyrsnpelts
    kvmrpsatfnaaidsla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g3uB (B:)
    skitytftdeapalatysllpivkafaasagidvetsdislagrilanfadrleadqrie
    ddlarlavlatspdaniiklpnisasvpqlkgaiaelqglgykvpdfpedpqtdeekevr
    aryakilgsavnpvlregnsdrrapaavkayarkhphsmgkwsmasrshadymrggdffs
    seqsitmakagdvriefvgkdgkvevkkqlslqegevldsmfmscgklrdffektlqdck
    etgvmwslhvkatmmkishpivfghavsvyykdvfdkwgqlfeelgvnpnngissvydki
    kslpasqqeeilhdihevyshrpemamvdsvkgitnlhipsdvivdasmpamirnsgqmw
    gkdgkqkdtkavmpestyariyqeminfcktngafdpttmgsvpnvglmaqkaeeygshd
    ktfemtadgtmrvvladgsvlmqhkvetgdiwracqtkdapirdwvklavtrarqsdtpa
    ifwldperahdrelrkkvelylkdhdltgldisimgyneairvsmerlirgkdtisvtgn
    vlrdyltdlfpimelgtsakmlsivplmagggmyetgaggsapkhvqqlveenylrwdsl
    geflalavsleetgiktgnakakllgkaldeatgklldnnkspsrkvgdidnrgshfyla
    mywaqalaaqnedaelkahfaplakalteqeativaelnavqgkpaeiggyyrsnpelts
    kvmrpsatfnaaidsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3uB (B:)
    skitytftdeapalatysllpivkafaasagidvetsdislagrilanfadrleadqrie
    ddlarlavlatspdaniiklpnisasvpqlkgaiaelqglgykvpdfpedpqtdeekevr
    aryakilgsavnpvlregnsdrrapaavkayarkhphsmgkwsmasrshadymrggdffs
    seqsitmakagdvriefvgkdgkvevkkqlslqegevldsmfmscgklrdffektlqdck
    etgvmwslhvkatmmkishpivfghavsvyykdvfdkwgqlfeelgvnpnngissvydki
    kslpasqqeeilhdihevyshrpemamvdsvkgitnlhipsdvivdasmpamirnsgqmw
    gkdgkqkdtkavmpestyariyqeminfcktngafdpttmgsvpnvglmaqkaeeygshd
    ktfemtadgtmrvvladgsvlmqhkvetgdiwracqtkdapirdwvklavtrarqsdtpa
    ifwldperahdrelrkkvelylkdhdltgldisimgyneairvsmerlirgkdtisvtgn
    vlrdyltdlfpimelgtsakmlsivplmagggmyetgaggsapkhvqqlrwdslgeflal
    avsleetgiktgnakakllgkaldeatgklldnnkspsrkvgdidnrgshfylamywaqa
    laaqnedaelkahfaplakalteqeativaelnavqgkpaeiggyyrsnpeltskvmrps
    atfnaaidsl