SCOPe 2.08: Domain d5occa2: 5occ A:131-218

Lineage for d5occa2 (5occ A:131-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d5occa2: 5occ A:131-218 [355282]
   Other proteins in same PDB: d5occh_, d5occl1, d5occl2
   automated match to d2fcba2
   complexed with gol, nag, po4

Details for d5occa2

PDB Entry: 5occ, 2.5 Å

PDB Description: crystal structure of cd32b (fc gamma receptor iib) in complex with human igg1 fab fragment (6g08)

PDB Compounds: (A:) Low affinity immunoglobulin gamma Fc region receptor II-b

SCOPe Domain Sequences for d5occa2:

Sequence; same for both SEQRES and ATOM records:

>d5occa2 b.1.1.4 (A:131-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewlvlqtphlefqegetivlrchswkdkplvkvtffqngkskkfsrsdpnfsipqanhsh
sgdyhctgnigytlysskpvtitvqaps

Timeline for d5occa2:

• d5occa2 first appeared in SCOPe 2.07