Lineage for d5occa2 (5occ A:131-218)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.4: I set domains [49159] (39 proteins)
  6. Protein automated matches [190803] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. Domain d5occa2: 5occ A:131-218 [355282]
    Other proteins in same PDB: d5occh_, d5occl1, d5occl2
    automated match to d2fcba2
    complexed with gol, nag, po4

Details for d5occa2

PDB Entry: 5occ (more details), 2.5 Å

PDB Description: crystal structure of cd32b (fc gamma receptor iib) in complex with human igg1 fab fragment (6g08)
PDB Compounds: (A:) Low affinity immunoglobulin gamma Fc region receptor II-b

SCOPe Domain Sequences for d5occa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5occa2 b.1.1.4 (A:131-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewlvlqtphlefqegetivlrchswkdkplvkvtffqngkskkfsrsdpnfsipqanhsh
sgdyhctgnigytlysskpvtitvqaps

SCOPe Domain Coordinates for d5occa2 are not available.

Timeline for d5occa2:

Domains from same chain:
(mouse over for more information)
d5occa1
Domains from other chains:
(mouse over for more information)
d5occh_, d5occl1, d5occl2