PDB entry 5occ

View 5occ on RCSB PDB site
Description: Crystal structure of CD32b (Fc Gamma Receptor IIb) in complex with Human IgG1 Fab fragment (6G08)
Class: immune system
Keywords: cd32b, Complex, Fab, mAb, immune system
Deposited on 2017-06-30, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin gamma Fc region receptor II-b
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR2B, CD32, FCG2, IGFR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5occa1, d5occa2
  • Chain 'H':
    Compound: 6G08 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCC (0-221)
  • Chain 'L':
    Compound: 6G08 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCC (0-End)
    Domains in SCOPe 2.07: d5occl1, d5occl2
  • Heterogens: NAG, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5occA (A:)
    tpaappkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfk
    annndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetivlrchswkdkplvk
    vtffqngkskkfsrsdpnfsipqanhshsgdyhctgnigytlysskpvtitvqaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >5occA (A:)
    lklepqwinvlqedsvtltcresdsiqwfhngnlipthtqpsyrfkannndsgeytcqtg
    qtslsdpvhltvlsewlvlqtphlefqegetivlrchswkdkplvkvtffqngkskkfsr
    sdpnfsipqanhshsgdyhctgnigytlysskpvtitvqaps
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5occL (L:)
    qsvltqppsasgtpgqrvtisctgsssnigagydvhwyqqlpgtapklliygdtnrpsgv
    pdrfsgsksgtsaslaisglrsedeadyycaawddslngpvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5occL (L:)
    qsvltqppsasgtpgqrvtisctgsssnigagydvhwyqqlpgtapklliygdtnrpsgv
    pdrfsgsksgtsaslaisglrsedeadyycaawddslngpvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec