Lineage for d5occl2 (5occ L:113-216)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (17 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 3055144Domain d5occl2: 5occ L:113-216 [355206]
    Other proteins in same PDB: d5occa1, d5occa2, d5occl1
    automated match to d2fb4l2
    complexed with gol, nag, po4

Details for d5occl2

PDB Entry: 5occ (more details), 2.5 Å

PDB Description: crystal structure of cd32b (fc gamma receptor iib) in complex with human igg1 fab fragment (6g08)
PDB Compounds: (L:) 6G08 Fab Light Chain

SCOPe Domain Sequences for d5occl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5occl2 b.1.1.2 (L:113-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d5occl2:

Click to download the PDB-style file with coordinates for d5occl2.
(The format of our PDB-style files is described here.)

Timeline for d5occl2:

  • d5occl2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5occl1