SCOPe 2.08: Domain d5occa1: 5occ A:52-130

Lineage for d5occa1 (5occ A:52-130)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d5occa1: 5occ A:52-130 [355281]
   Other proteins in same PDB: d5occh_, d5occl1, d5occl2
   automated match to d2fcba1
   complexed with gol, nag, po4

Details for d5occa1

PDB Entry: 5occ, 2.5 Å

PDB Description: crystal structure of cd32b (fc gamma receptor iib) in complex with human igg1 fab fragment (6g08)

PDB Compounds: (A:) Low affinity immunoglobulin gamma Fc region receptor II-b

SCOPe Domain Sequences for d5occa1:

Sequence, based on SEQRES records:

>d5occa1 b.1.1.4 (A:52-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkannndsgey
tcqtgqtslsdpvhltvls

Sequence, based on observed residues (ATOM records):

>d5occa1 b.1.1.4 (A:52-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lklepqwinvlqedsvtltcresdsiqwfhngnlipthtqpsyrfkannndsgeytcqtg
qtslsdpvhltvls

Timeline for d5occa1:

• d5occa1 first appeared in SCOPe 2.07