Lineage for d5occa1 (5occ A:52-130)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2355180Protein automated matches [190803] (3 species)
    not a true protein
  7. 2355181Species Human (Homo sapiens) [TaxId:9606] [188070] (28 PDB entries)
  8. 3055219Domain d5occa1: 5occ A:52-130 [355281]
    Other proteins in same PDB: d5occl1, d5occl2
    automated match to d2fcba1
    complexed with gol, nag, po4

Details for d5occa1

PDB Entry: 5occ (more details), 2.5 Å

PDB Description: crystal structure of cd32b (fc gamma receptor iib) in complex with human igg1 fab fragment (6g08)
PDB Compounds: (A:) Low affinity immunoglobulin gamma Fc region receptor II-b

SCOPe Domain Sequences for d5occa1:

Sequence, based on SEQRES records: (download)

>d5occa1 b.1.1.4 (A:52-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkannndsgey
tcqtgqtslsdpvhltvls

Sequence, based on observed residues (ATOM records): (download)

>d5occa1 b.1.1.4 (A:52-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lklepqwinvlqedsvtltcresdsiqwfhngnlipthtqpsyrfkannndsgeytcqtg
qtslsdpvhltvls

SCOPe Domain Coordinates for d5occa1:

Click to download the PDB-style file with coordinates for d5occa1.
(The format of our PDB-style files is described here.)

Timeline for d5occa1:

  • d5occa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5occa2