SCOPe 2.08: Domain d6fs6f1: 6fs6 F:1-198

Lineage for d6fs6f1 (6fs6 F:1-198)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (8 species)

7. Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)

8. Domain d6fs6f1: 6fs6 F:1-198 [354620]
   Other proteins in same PDB: d6fs6a2, d6fs6b2, d6fs6c2, d6fs6d2, d6fs6e2, d6fs6f2
   automated match to d4e5ec_
   complexed with e4z, mn

Details for d6fs6f1

PDB Entry: 6fs6, 2.29 Å

PDB Description: influenza a/california/04/2009 (ph1n1) endonuclease with bound inhibitor, baloxavir acid (bxa)

PDB Compounds: (F:) Polymerase acidic protein,Polymerase acidic protein

SCOPe Domain Sequences for d6fs6f1:

Sequence, based on SEQRES records:

>d6fs6f1 c.52.1.34 (F:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfgsgdpnall
khrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyyl
ekankiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfr
qserge

Sequence, based on observed residues (ATOM records):

>d6fs6f1 c.52.1.34 (F:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdhrfeiiegrd
rimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankikkthi
hifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge

Timeline for d6fs6f1:

• d6fs6f1 first appeared in SCOPe 2.07