Lineage for d6bw9a_ (6bw9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726105Domain d6bw9a_: 6bw9 A: [354193]
    automated match to d4uaea_

Details for d6bw9a_

PDB Entry: 6bw9 (more details), 1.6 Å

PDB Description: hendra virus w protein c-terminus in complex with importin alpha 3 crystal form 1
PDB Compounds: (A:) Importin subunit alpha-3

SCOPe Domain Sequences for d6bw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bw9a_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnpsl
qfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgpqc
rdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcvli
hhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravgni
vtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanlvp
miihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvqvv
ldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffss

SCOPe Domain Coordinates for d6bw9a_:

Click to download the PDB-style file with coordinates for d6bw9a_.
(The format of our PDB-style files is described here.)

Timeline for d6bw9a_: