Lineage for d4uaea_ (4uae A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726174Domain d4uaea_: 4uae A: [309699]
    Other proteins in same PDB: d4uaef_
    automated match to d3feyc_
    complexed with so4

Details for d4uaea_

PDB Entry: 4uae (more details), 2.7 Å

PDB Description: importin alpha 3 delta ibb in complex with influenza pb2 nuclear localization domain
PDB Compounds: (A:) Importin subunit alpha-3

SCOPe Domain Sequences for d4uaea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uaea_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnps
lqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgpq
crdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcvl
ihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravgn
ivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanlv
pmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvqv
vldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffss

SCOPe Domain Coordinates for d4uaea_:

Click to download the PDB-style file with coordinates for d4uaea_.
(The format of our PDB-style files is described here.)

Timeline for d4uaea_: