SCOPe 2.08: Domain d6bs2b2: 6bs2 B:244-428

Lineage for d6bs2b2 (6bs2 B:244-428)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d6bs2b2: 6bs2 B:244-428 [353858]
Other proteins in same PDB: d6bs2a1, d6bs2b1, d6bs2c1, d6bs2d1, d6bs2e_, d6bs2f1, d6bs2f2, d6bs2f3
automated match to d3rycd2
complexed with acp, ca, e9y, gdp, gtp, mes, mg

Details for d6bs2b2

PDB Entry: 6bs2 (more details), 2.65 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 8b

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6bs2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bs2b2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d6bs2b2:

Click to download the PDB-style file with coordinates for d6bs2b2.
(The format of our PDB-style files is described here.)

Timeline for d6bs2b2: