Lineage for d6bs2b1 (6bs2 B:2-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445466Species Pig (Sus scrofa) [TaxId:9823] [278808] (24 PDB entries)
  8. 3053795Domain d6bs2b1: 6bs2 B:2-243 [353857]
    Other proteins in same PDB: d6bs2a2, d6bs2b2, d6bs2c2, d6bs2d2, d6bs2e_, d6bs2f1, d6bs2f2, d6bs2f3
    automated match to d4drxb1
    complexed with acp, ca, e9y, gdp, gtp, mes, mg

Details for d6bs2b1

PDB Entry: 6bs2 (more details), 2.65 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 8b
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6bs2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bs2b1 c.32.1.1 (B:2-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d6bs2b1:

Click to download the PDB-style file with coordinates for d6bs2b1.
(The format of our PDB-style files is described here.)

Timeline for d6bs2b1:

  • d6bs2b1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28