![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (7 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [278808] (24 PDB entries) |
![]() | Domain d6bs2d1: 6bs2 D:1-243 [353861] Other proteins in same PDB: d6bs2a2, d6bs2b2, d6bs2c2, d6bs2d2, d6bs2e_, d6bs2f1, d6bs2f2, d6bs2f3 automated match to d4drxb1 complexed with acp, ca, e9y, gdp, gtp, mes, mg |
PDB Entry: 6bs2 (more details), 2.65 Å
SCOPe Domain Sequences for d6bs2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bs2d1 c.32.1.1 (D:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d6bs2d1: