SCOPe 2.07: Domain d6bs2d1: 6bs2 D:1-243

Lineage for d6bs2d1 (6bs2 D:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (24 PDB entries)

8. Domain d6bs2d1: 6bs2 D:1-243 [353861]
   Other proteins in same PDB: d6bs2a2, d6bs2b2, d6bs2c2, d6bs2d2, d6bs2e_, d6bs2f1, d6bs2f2, d6bs2f3
   automated match to d4drxb1
   complexed with acp, ca, e9y, gdp, gtp, mes, mg

Details for d6bs2d1

PDB Entry: 6bs2, 2.65 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 8b

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6bs2d1:

Sequence; same for both SEQRES and ATOM records:

>d6bs2d1 c.32.1.1 (D:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6bs2d1:

• d6bs2d1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28