Lineage for d6bs2f1 (6bs2 F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444379Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2444380Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2444381Species Chicken (Gallus gallus) [TaxId:9031] [311384] (84 PDB entries)
  8. 3053778Domain d6bs2f1: 6bs2 F:1-76 [353840]
    Other proteins in same PDB: d6bs2a1, d6bs2a2, d6bs2b1, d6bs2b2, d6bs2c1, d6bs2c2, d6bs2d1, d6bs2d2, d6bs2e_, d6bs2f2, d6bs2f3
    automated match to d3tiia1
    complexed with acp, ca, e9y, gdp, gtp, mes, mg

Details for d6bs2f1

PDB Entry: 6bs2 (more details), 2.65 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 8b
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d6bs2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bs2f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d6bs2f1:

Click to download the PDB-style file with coordinates for d6bs2f1.
(The format of our PDB-style files is described here.)

Timeline for d6bs2f1:

  • d6bs2f1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28