SCOPe 2.08: Domain d6bs2e_: 6bs2 E:

Lineage for d6bs2e_ (6bs2 E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d6bs2e_: 6bs2 E: [354114]
   Other proteins in same PDB: d6bs2a1, d6bs2a2, d6bs2b1, d6bs2b2, d6bs2c1, d6bs2c2, d6bs2d1, d6bs2d2, d6bs2f1, d6bs2f2, d6bs2f3
   automated match to d4i55e_
   complexed with acp, ca, e9y, gdp, gtp, mes, mg

Details for d6bs2e_

PDB Entry: 6bs2, 2.65 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 8b

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6bs2e_:

Sequence, based on SEQRES records:

>d6bs2e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d6bs2e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d6bs2e_:

• d6bs2e_ first appeared in SCOPe 2.07