Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d5ylsf2: 5yls F:77-378 [351056] Other proteins in same PDB: d5ylsa1, d5ylsa2, d5ylsb1, d5ylsb2, d5ylsc1, d5ylsc2, d5ylsd1, d5ylsd2, d5ylse_, d5ylsf1, d5ylsf3 automated match to d3tiia2 complexed with acp, ca, gdp, gol, gtp, mes, mg, y50 |
PDB Entry: 5yls (more details), 3 Å
SCOPe Domain Sequences for d5ylsf2:
Sequence, based on SEQRES records: (download)
>d5ylsf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5ylsf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwialisseasel ldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepyn sanfqdktchltnhciqknygryeegnemffeefnqylmdalnttlensillqikhiirs clmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdv aissvfplatsifikl
Timeline for d5ylsf2: