Lineage for d5ylsa1 (5yls A:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445284Species Chicken (Gallus gallus) [TaxId:9031] [278810] (14 PDB entries)
  8. 3051035Domain d5ylsa1: 5yls A:1-245 [351097]
    Other proteins in same PDB: d5ylsa2, d5ylsb2, d5ylsc2, d5ylsd2, d5ylse_, d5ylsf1, d5ylsf2, d5ylsf3
    automated match to d5fnva1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, y50

Details for d5ylsa1

PDB Entry: 5yls (more details), 3 Å

PDB Description: crystal structure of t2r-ttl-y50 complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5ylsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylsa1 c.32.1.1 (A:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5ylsa1:

Click to download the PDB-style file with coordinates for d5ylsa1.
(The format of our PDB-style files is described here.)

Timeline for d5ylsa1:

  • d5ylsa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-12