Lineage for d5ylsb2 (5yls B:244-428)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525709Species Pig (Sus scrofa) [TaxId:9823] [278816] (24 PDB entries)
  8. 3051029Domain d5ylsb2: 5yls B:244-428 [351091]
    Other proteins in same PDB: d5ylsa1, d5ylsb1, d5ylsc1, d5ylsd1, d5ylse_, d5ylsf1, d5ylsf2, d5ylsf3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, y50

Details for d5ylsb2

PDB Entry: 5yls (more details), 3 Å

PDB Description: crystal structure of t2r-ttl-y50 complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5ylsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylsb2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d5ylsb2:

Click to download the PDB-style file with coordinates for d5ylsb2.
(The format of our PDB-style files is described here.)

Timeline for d5ylsb2:

  • d5ylsb2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-12