![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
![]() | Domain d5ylsc2: 5yls C:246-440 [351025] Other proteins in same PDB: d5ylsa1, d5ylsb1, d5ylsc1, d5ylsd1, d5ylse_, d5ylsf1, d5ylsf2, d5ylsf3 automated match to d4i50a2 complexed with acp, ca, gdp, gol, gtp, mes, mg, y50 |
PDB Entry: 5yls (more details), 3 Å
SCOPe Domain Sequences for d5ylsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ylsc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5ylsc2: