Lineage for d5ylsf1 (5yls F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444379Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2444380Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2444381Species Chicken (Gallus gallus) [TaxId:9031] [311384] (98 PDB entries)
  8. 3050993Domain d5ylsf1: 5yls F:1-76 [351055]
    Other proteins in same PDB: d5ylsa1, d5ylsa2, d5ylsb1, d5ylsb2, d5ylsc1, d5ylsc2, d5ylsd1, d5ylsd2, d5ylse_, d5ylsf2, d5ylsf3
    automated match to d3tiia1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, y50

Details for d5ylsf1

PDB Entry: 5yls (more details), 3 Å

PDB Description: crystal structure of t2r-ttl-y50 complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5ylsf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylsf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5ylsf1:

Click to download the PDB-style file with coordinates for d5ylsf1.
(The format of our PDB-style files is described here.)

Timeline for d5ylsf1:

  • d5ylsf1 is new in SCOPe 2.07-stable