Lineage for d5ylse_ (5yls E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (99 PDB entries)
  8. 3050955Domain d5ylse_: 5yls E: [351017]
    Other proteins in same PDB: d5ylsa1, d5ylsa2, d5ylsb1, d5ylsb2, d5ylsc1, d5ylsc2, d5ylsd1, d5ylsd2, d5ylsf1, d5ylsf2, d5ylsf3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gol, gtp, mes, mg, y50

Details for d5ylse_

PDB Entry: 5yls (more details), 3 Å

PDB Description: crystal structure of t2r-ttl-y50 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5ylse_:

Sequence, based on SEQRES records: (download)

>d5ylse_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5ylse_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5ylse_:

Click to download the PDB-style file with coordinates for d5ylse_.
(The format of our PDB-style files is described here.)

Timeline for d5ylse_:

  • d5ylse_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-12