Lineage for d6fxne2 (6fxn E:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752106Domain d6fxne2: 6fxn E:108-211 [350711]
    Other proteins in same PDB: d6fxna_, d6fxnb_, d6fxnc_, d6fxnd1, d6fxnd2, d6fxne1, d6fxnf1, d6fxnf2, d6fxng1, d6fxnh1, d6fxnh2, d6fxni1, d6fxnj_, d6fxnk_, d6fxnl_, d6fxnm1, d6fxnm2, d6fxnn1, d6fxno1, d6fxno2, d6fxnp1, d6fxnq1, d6fxnq2, d6fxnr1
    automated match to d4ocrl2

Details for d6fxne2

PDB Entry: 6fxn (more details), 2.9 Å

PDB Description: crystal structure of human baff in complex with fab fragment of anti- baff antibody belimumab
PDB Compounds: (E:) belimumab light chain

SCOPe Domain Sequences for d6fxne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxne2 b.1.1.2 (E:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d6fxne2:

Click to download the PDB-style file with coordinates for d6fxne2.
(The format of our PDB-style files is described here.)

Timeline for d6fxne2: