![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d6fxng2: 6fxn G:108-211 [350802] Other proteins in same PDB: d6fxna_, d6fxnb_, d6fxnc_, d6fxnd1, d6fxnd2, d6fxne1, d6fxnf1, d6fxnf2, d6fxng1, d6fxnh1, d6fxnh2, d6fxni1, d6fxnj_, d6fxnk_, d6fxnl_, d6fxnm1, d6fxnm2, d6fxnn1, d6fxno1, d6fxno2, d6fxnp1, d6fxnq1, d6fxnq2, d6fxnr1 automated match to d4ocrl2 |
PDB Entry: 6fxn (more details), 2.9 Å
SCOPe Domain Sequences for d6fxng2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fxng2 b.1.1.2 (G:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d6fxng2:
![]() Domains from other chains: (mouse over for more information) d6fxna_, d6fxnb_, d6fxnc_, d6fxnd1, d6fxnd2, d6fxne1, d6fxne2, d6fxnf1, d6fxnf2, d6fxnh1, d6fxnh2, d6fxni1, d6fxni2, d6fxnj_, d6fxnk_, d6fxnl_, d6fxnm1, d6fxnm2, d6fxnn1, d6fxnn2, d6fxno1, d6fxno2, d6fxnp1, d6fxnp2, d6fxnq1, d6fxnq2, d6fxnr1, d6fxnr2 |