Lineage for d6fxnj_ (6fxn J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777312Protein Soluble part of TALL-1, sTALL-1 (BAFF) [69228] (1 species)
  7. 2777313Species Human (Homo sapiens) [TaxId:9606] [69229] (9 PDB entries)
    also includes the PDB entry (1otz) that together with the entry (1p0t) provides the multimeric structure of the complex of this protein with its receptor, BAFF-R. In these entries protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
  8. 2777350Domain d6fxnj_: 6fxn J: [350808]
    Other proteins in same PDB: d6fxnd1, d6fxnd2, d6fxne1, d6fxne2, d6fxnf1, d6fxnf2, d6fxng1, d6fxng2, d6fxnh1, d6fxnh2, d6fxni1, d6fxni2, d6fxnm1, d6fxnm2, d6fxnn1, d6fxnn2, d6fxno1, d6fxno2, d6fxnp1, d6fxnp2, d6fxnq1, d6fxnq2, d6fxnr1, d6fxnr2
    automated match to d1kxga_

Details for d6fxnj_

PDB Entry: 6fxn (more details), 2.9 Å

PDB Description: crystal structure of human baff in complex with fab fragment of anti- baff antibody belimumab
PDB Compounds: (J:) tumor necrosis factor ligand superfamily member 13b

SCOPe Domain Sequences for d6fxnj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxnj_ b.22.1.1 (J:) Soluble part of TALL-1, sTALL-1 (BAFF) {Human (Homo sapiens) [TaxId: 9606]}
vtqdclqliadsetptiqkgsytfvpwllsfkrgsaleekenkilvketgyffiygqvly
tdktyamghliqrkkvavfgdelslvtlfrciqnmpetlpnnscysagiakleegdelql
aiprenaqisldgdvtffgalkll

SCOPe Domain Coordinates for d6fxnj_:

Click to download the PDB-style file with coordinates for d6fxnj_.
(The format of our PDB-style files is described here.)

Timeline for d6fxnj_: