SCOPe 2.08: Domain d6fxnm1: 6fxn M:9-223

Lineage for d6fxnm1 (6fxn M:9-223)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6fxnm1: 6fxn M:9-223 [411144]
   Other proteins in same PDB: d6fxna_, d6fxnb_, d6fxnc_, d6fxnd2, d6fxne2, d6fxnf2, d6fxng2, d6fxnh2, d6fxni2, d6fxnj_, d6fxnk_, d6fxnl_, d6fxnm2, d6fxnn2, d6fxno2, d6fxnp2, d6fxnq2, d6fxnr2
   automated match to d6shgh_

Details for d6fxnm1

PDB Entry: 6fxn, 2.9 Å

PDB Description: crystal structure of human baff in complex with fab fragment of anti- baff antibody belimumab

PDB Compounds: (M:) belimumab heavy chain

SCOPe Domain Sequences for d6fxnm1:

Sequence, based on SEQRES records:

>d6fxnm1 b.1.1.0 (M:9-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevkkpgssvrvsckasggtfnnnainwvrqapgqglewmggiipmfgtakysqnfqgrv
aitadestgtasmelsslrsedtavyycarsrdlllfphhalspwgrgtmvtvssastkg
psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d6fxnm1 b.1.1.0 (M:9-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevkkpgssvrvsckasggtfnnnainwvrqapgqglewmggiipmfgtakysqnfqgrv
aitadestgtasmelsslrsedtavyycarsrdlllfphhalspwgrgtmvtvssastkg
psvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvp
ssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d6fxnm1:

• d6fxnm1 is new in SCOPe 2.08-stable