SCOPe 2.08: Domain d6fxna_: 6fxn A:

Lineage for d6fxna_ (6fxn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Soluble part of TALL-1, sTALL-1 (BAFF) [69228] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69229] (9 PDB entries)
   also includes the PDB entry (1otz) that together with the entry (1p0t) provides the multimeric structure of the complex of this protein with its receptor, BAFF-R. In these entries protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d6fxna_: 6fxn A: [350709]
   Other proteins in same PDB: d6fxnd1, d6fxnd2, d6fxne1, d6fxne2, d6fxnf1, d6fxnf2, d6fxng1, d6fxng2, d6fxnh1, d6fxnh2, d6fxni1, d6fxni2, d6fxnm1, d6fxnm2, d6fxnn1, d6fxnn2, d6fxno1, d6fxno2, d6fxnp1, d6fxnp2, d6fxnq1, d6fxnq2, d6fxnr1, d6fxnr2
   automated match to d1kxga_

Details for d6fxna_

PDB Entry: 6fxn, 2.9 Å

PDB Description: crystal structure of human baff in complex with fab fragment of anti- baff antibody belimumab

PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 13b

SCOPe Domain Sequences for d6fxna_:

Sequence; same for both SEQRES and ATOM records:

>d6fxna_ b.22.1.1 (A:) Soluble part of TALL-1, sTALL-1 (BAFF) {Human (Homo sapiens) [TaxId: 9606]}
vtqdclqliadsetptiqkgsytfvpwllsfkrgsaleekenkilvketgyffiygqvly
tdktyamghliqrkkvavfgdelslvtlfrciqnmpetlpnnscysagiakleegdelql
aiprenaqisldgdvtffgalkll

Timeline for d6fxna_:

• d6fxna_ first appeared in SCOPe 2.07