![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Soluble part of TALL-1, sTALL-1 (BAFF) [69228] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69229] (9 PDB entries) also includes the PDB entry (1otz) that together with the entry (1p0t) provides the multimeric structure of the complex of this protein with its receptor, BAFF-R. In these entries protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP |
![]() | Domain d6fxnl_: 6fxn L: [350647] Other proteins in same PDB: d6fxnd1, d6fxnd2, d6fxne1, d6fxne2, d6fxnf1, d6fxnf2, d6fxng1, d6fxng2, d6fxnh1, d6fxnh2, d6fxni1, d6fxni2, d6fxnm1, d6fxnm2, d6fxnn1, d6fxnn2, d6fxno1, d6fxno2, d6fxnp1, d6fxnp2, d6fxnq1, d6fxnq2, d6fxnr1, d6fxnr2 automated match to d1kxga_ |
PDB Entry: 6fxn (more details), 2.9 Å
SCOPe Domain Sequences for d6fxnl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fxnl_ b.22.1.1 (L:) Soluble part of TALL-1, sTALL-1 (BAFF) {Human (Homo sapiens) [TaxId: 9606]} vtqdclqliadsetptiqkgsytfvpwllsfkrgsaleekenkilvketgyffiygqvly tdktyamghliqrkkvavfgdelslvtlfrciqnmpetlpnnscysagiakleegdelql aiprenaqisldgdvtffgalkll
Timeline for d6fxnl_:
![]() Domains from other chains: (mouse over for more information) d6fxna_, d6fxnb_, d6fxnc_, d6fxnd1, d6fxnd2, d6fxne1, d6fxne2, d6fxnf1, d6fxnf2, d6fxng1, d6fxng2, d6fxnh1, d6fxnh2, d6fxni1, d6fxni2, d6fxnj_, d6fxnk_, d6fxnm1, d6fxnm2, d6fxnn1, d6fxnn2, d6fxno1, d6fxno2, d6fxnp1, d6fxnp2, d6fxnq1, d6fxnq2, d6fxnr1, d6fxnr2 |