Lineage for d6au7c1 (6au7 C:1-36)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635463Protein automated matches [197331] (11 species)
    not a true protein
  7. 2635478Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries)
  8. 2635481Domain d6au7c1: 6au7 C:1-36 [349154]
    Other proteins in same PDB: d6au7a2, d6au7b2, d6au7c2, d6au7d2
    automated match to d1j5ja_
    complexed with gol, so4

Details for d6au7c1

PDB Entry: 6au7 (more details), 1.9 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox
PDB Compounds: (C:) Potassium channel toxin gamma-KTx 2.2

SCOPe Domain Sequences for d6au7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6au7c1 g.3.7.2 (C:1-36) automated matches {Mesobuthus martensii [TaxId: 34649]}
rptdikcsasyqcfpvcksrfgktngrcvnglcdcf

SCOPe Domain Coordinates for d6au7c1:

Click to download the PDB-style file with coordinates for d6au7c1.
(The format of our PDB-style files is described here.)

Timeline for d6au7c1: