SCOPe 2.08: Domain d6au7c1: 6au7 C:1-36

Lineage for d6au7c1 (6au7 C:1-36)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein automated matches [197331] (11 species)
   not a true protein

7. Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries)

8. Domain d6au7c1: 6au7 C:1-36 [349154]
   Other proteins in same PDB: d6au7a2, d6au7b2, d6au7c2, d6au7d2
   automated match to d1j5ja_
   complexed with gol, so4

Details for d6au7c1

PDB Entry: 6au7, 1.9 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox

PDB Compounds: (C:) Potassium channel toxin gamma-KTx 2.2

SCOPe Domain Sequences for d6au7c1:

Sequence; same for both SEQRES and ATOM records:

>d6au7c1 g.3.7.2 (C:1-36) automated matches {Mesobuthus martensii [TaxId: 34649]}
rptdikcsasyqcfpvcksrfgktngrcvnglcdcf

Timeline for d6au7c1:

• d6au7c1 first appeared in SCOPe 2.07