PDB entry 6au7

View 6au7 on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on 2017-08-30, released 2018-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin gamma-KTx 2.2
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59938 (2-37)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6au7a1, d6au7a2
  • Chain 'B':
    Compound: Potassium channel toxin gamma-KTx 2.2
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59938 (2-37)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6au7b1, d6au7b2
  • Chain 'C':
    Compound: Potassium channel toxin gamma-KTx 2.2
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59938 (2-37)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6au7c1, d6au7c2
  • Chain 'D':
    Compound: Potassium channel toxin gamma-KTx 2.2
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59938 (2-37)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6au7d1, d6au7d2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6au7A (A:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6au7B (B:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6au7C (C:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6au7D (D:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf