PDB entry 6au7
View 6au7 on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on
2017-08-30, released
2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated
2018-03-14, with a file datestamp of
2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6au7a1, d6au7a2 - Chain 'B':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6au7b1, d6au7b2 - Chain 'C':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6au7c1, d6au7c2 - Chain 'D':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6au7d1, d6au7d2 - Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6au7A (A:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6au7B (B:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>6au7C (C:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>6au7D (D:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf