Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
Protein automated matches [197331] (11 species) not a true protein |
Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries) |
Domain d6au7a1: 6au7 A:1-36 [349168] Other proteins in same PDB: d6au7a2, d6au7b2, d6au7c2, d6au7d2 automated match to d1j5ja_ complexed with gol, so4 |
PDB Entry: 6au7 (more details), 1.9 Å
SCOPe Domain Sequences for d6au7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6au7a1 g.3.7.2 (A:1-36) automated matches {Mesobuthus martensii [TaxId: 34649]} rptdikcsasyqcfpvcksrfgktngrcvnglcdcf
Timeline for d6au7a1: