Lineage for d5wcta_ (5wct A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882703Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2882707Protein PA N-terminal domain [254375] (8 species)
  7. 2882737Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. 2882845Domain d5wcta_: 5wct A: [347995]
    automated match to d4e5ed_
    complexed with gy4, mn

Details for d5wcta_

PDB Entry: 5wct (more details), 2.3 Å

PDB Description: crystal structure of the influenza virus pa endonuclease in complex with inhibitor 6c (sri-29775)
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5wcta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wcta_ c.52.1.34 (A:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser

SCOPe Domain Coordinates for d5wcta_:

Click to download the PDB-style file with coordinates for d5wcta_.
(The format of our PDB-style files is described here.)

Timeline for d5wcta_: