SCOPe 2.08: Domain d5oy0j_: 5oy0 J:

Lineage for d5oy0j_ (5oy0 J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)

6. Protein automated matches [236565] (3 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [347611] (2 PDB entries)

8. Domain d5oy0j_: 5oy0 J: [347612]
   Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy05_, d5oy06_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0k_, d5oy0l_
   automated match to d4kt0j_
   complexed with 45d, act, bcr, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd, zex

Details for d5oy0j_

PDB Entry: 5oy0, 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution

PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d5oy0j_:

Sequence; same for both SEQRES and ATOM records:

>d5oy0j_ f.23.18.1 (J:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdglksflstapvmimalltftagiliefnrfypdllfhp

Timeline for d5oy0j_:

• d5oy0j_ first appeared in SCOPe 2.07