Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) |
Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins) |
Protein automated matches [347293] (1 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [347294] (2 PDB entries) |
Domain d5oy0i_: 5oy0 I: [347327] Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0e_, d5oy0f_, d5oy0j_, d5oy0k_, d5oy0l_ automated match to d1jb0i_ complexed with 45d, act, bcr, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd, zex |
PDB Entry: 5oy0 (more details), 2.5 Å
SCOPe Domain Sequences for d5oy0i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oy0i_ f.23.17.1 (I:) automated matches {Synechocystis sp. [TaxId: 1111708]} mdgsyaasylpwilipmvgwlfpavtmgllfihiesegeg
Timeline for d5oy0i_: