SCOPe 2.08: Domain d5oy00_: 5oy0 0:

Lineage for d5oy00_ (5oy0 0:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
   core: three transmembrane helices, bundle

4. Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families)
   automatically mapped to Pfam PF02605

5. Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)

6. Protein automated matches [347525] (2 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [347526] (2 PDB entries)

8. Domain d5oy00_: 5oy0 0: [347689]
   Other proteins in same PDB: d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_
   automated match to d1jb0l_
   complexed with 45d, act, bcr, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd, zex

Details for d5oy00_

PDB Entry: 5oy0, 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution

PDB Compounds: (0:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d5oy00_:

Sequence; same for both SEQRES and ATOM records:

>d5oy00_ f.31.1.1 (0:) automated matches {Synechocystis sp. [TaxId: 1111708]}
snqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyflig
pwtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgwsqf
aagffvggmggafvayfllenlsvvdgifrglfn

Timeline for d5oy00_:

• d5oy00_ first appeared in SCOPe 2.07