Lineage for d5oy0e_ (5oy0 e:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783757Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
    automatically mapped to Pfam PF02427
  6. 2783773Protein automated matches [347347] (4 species)
    not a true protein
  7. 2783779Species Synechocystis sp. [TaxId:1111708] [347348] (1 PDB entry)
  8. 2783781Domain d5oy0e_: 5oy0 e: [347349]
    Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_
    automated match to d1gxie_
    complexed with 45d, act, bcr, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd, zex

Details for d5oy0e_

PDB Entry: 5oy0 (more details), 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution
PDB Compounds: (e:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d5oy0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oy0e_ b.34.4.2 (e:) automated matches {Synechocystis sp. [TaxId: 1111708]}
alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
aenelelv

SCOPe Domain Coordinates for d5oy0e_:

Click to download the PDB-style file with coordinates for d5oy0e_.
(The format of our PDB-style files is described here.)

Timeline for d5oy0e_: