Lineage for d5ganj_ (5gan J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333873Protein Pre-mRNA splicing factor 6 [346027] (2 species)
  7. 2333874Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346188] (1 PDB entry)
  8. 2333875Domain d5ganj_: 5gan J: [345636]
    Other proteins in same PDB: d5gane_, d5ganf1, d5ganf2, d5gang1, d5gang2
    complexed with gtp

Details for d5ganj_

PDB Entry: 5gan (more details), 3.6 Å

PDB Description: the overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
PDB Compounds: (J:) Pre-mRNA-splicing factor 6

SCOPe Domain Sequences for d5ganj_:

Sequence, based on SEQRES records: (download)

>d5ganj_ a.118.8.1 (J:) Pre-mRNA splicing factor 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gnvdlnklteerekllqsqidenlaqltknasnpiqvnkpnaatdalsylkdlendrvns
lsdatledlqkmrtilksyrkadptnpqgwiasarleekarkfsvakkiiengcqecprs
sdiwlenirlhesdvhycktlvatainfnptspllwfkaidlesttvnkyrvvrkalqei
prdeglwklavsfeadkaqvikmlekatqfipqsmdlltaytnlqsyhnakmtlnsfrki
lpqepeiwiistlleernnpdipvdklvsllkegllelskngykatlsawlkraealnda
pnsnltcqaivyailewlresgeyeselnnvdqilekmphskvqiavlkkliqwdpcdtv
lwsrlkmatesyhkieellaffqellfqtknsddiranmrekspgllmmyvseywkaqkg
dtrqtlvlidqiidfaphnldlrffkikllgrslqldelrdffqqtfssledfkisgter
lyykyvnflryqdlneeaikflnerclksfpichkfflqlgqiyhsmgniemsretylsg
trlvpncpllwvslskideidlknpvrarsildrgllknpddvlfyiakiqmeirlgnld
qaellvtqalqkfpsnallwveqiklfkhgnksslkktifqdalrrtqndhrvlleigvs
fyaeaqyetslkwleralkkcsrygdtwvwlfrtyarlgkdtvdlynmfdqceptygpew
iaasknvkmqyctpreillrlmnd

Sequence, based on observed residues (ATOM records): (download)

>d5ganj_ a.118.8.1 (J:) Pre-mRNA splicing factor 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gnvdlnklteerekllqsqidenlaqltknasnpiqvnkpnaatdalsylkdlendrvns
lsdatledlqkmrtilksyrkadptnpqgwiasarleekarkfsvakkiiengcqecprs
sdiwlenirlhesdvhycktlvatainfnptspllwfkaidlesttvnkyrvvrkalqei
prdeglwklavsfeadkaqvikmlekatqfipqsmdlltaytnlqsyhnakmtlnsfrki
lpqepeiwiistlleernnpklvsllkegllelskngykatlsawlkraealndapnsnl
tcqaivyailewlresgeyeselnnvdqilekmphskvqiavlkkliqwdpcdtvlwsrl
kmatesyeellaffqellfqtsddiranmrekspgllmmyvseywkaqkgdtrqtlvlid
qiidfaphnldlrffkikllgrslqldelrdffqqtfssledfkisgterlyykyvnflr
yqdlneeaikflnerclksfpichkfflqlgqiyhsmgniemsretylsgtrlvpncpll
wvslskideidlknpvrarsildrgllknpddvlfyiakiqmeirlgnldqaellvtqal
qkfpsnallwveqiklfkhgnksslkktifqdalrrtqndhrvlleigvsfyaeaqyets
lkwleralkkcsrygdtwvwlfrtyarlgkdtvdlynmfdqceptygpewiaasknctpr
eillrlmnd

SCOPe Domain Coordinates for d5ganj_:

Click to download the PDB-style file with coordinates for d5ganj_.
(The format of our PDB-style files is described here.)

Timeline for d5ganj_:

  • d5ganj_ is new in SCOPe 2.07-stable