SCOPe 2.08: Domain d5gang2: 5gan G:336-467

Lineage for d5gang2 (5gan G:336-467)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.3: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 C-terminal domain-like [345972] (1 protein)
   Pfam PF06544; relationship to BLUF domain discussed in PubMed 26161500

6. Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 [346095] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346360] (4 PDB entries)

8. Domain d5gang2: 5gan G:336-467 [345635]
   Other proteins in same PDB: d5gane_, d5ganf1, d5ganf2, d5gang1, d5ganj_
   complexed with gtp

Details for d5gang2

PDB Entry: 5gan, 3.6 Å

PDB Description: the overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom

PDB Compounds: (G:) U4/U6 small nuclear ribonucleoprotein Prp3

SCOPe Domain Sequences for d5gang2:

Sequence; same for both SEQRES and ATOM records:

>d5gang2 d.58.10.3 (G:336-467) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vyhckvfqfknlqnpkirfklkmnskelslkglclrirddgpgiiivvgneksckfyenl
vmkrikwnedfelhtntgdikmdmhnnsisktwegylqdckfkgwfmkvcndqdsllrtl
gqfdsehfyspv

Timeline for d5gang2:

• d5gang2 first appeared in SCOPe 2.07