SCOPe 2.08: Domain d5gang1: 5gan G:150-335

Lineage for d5gang1 (5gan G:150-335)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.144: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [345908] (1 superfamily)
   Extended helices and loops that interact with other spliceosome components

4. Superfamily j.144.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [345944] (1 family)
   Pfam PF08572

5. Family j.144.1.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [346002] (1 protein)

6. Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 [346145] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346463] (1 PDB entry)

8. Domain d5gang1: 5gan G:150-335 [345634]
   Other proteins in same PDB: d5gane_, d5ganf1, d5ganf2, d5gang2, d5ganj_
   complexed with gtp

Details for d5gang1

PDB Entry: 5gan, 3.6 Å

PDB Description: the overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom

PDB Compounds: (G:) U4/U6 small nuclear ribonucleoprotein Prp3

SCOPe Domain Sequences for d5gang1:

Sequence; same for both SEQRES and ATOM records:

>d5gang1 j.144.1.1 (G:150-335) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lldlskfkiyydnnhgyewwdtayldekgelmekydmngtspaeeklaedidevdddddd
ehpsiryvahplpekineakvsikayltqherkrlrrnrrkmareareikiklgllpkpe
pkvklsnmmsvfendqnitdptawekvvkdqvdlrkrkhleenerrhedaikrrkeavnm
nvekpt

Timeline for d5gang1:

• d5gang1 first appeared in SCOPe 2.07